Structure of PDB 8esr Chain X Binding Site BS03

Receptor Information
>8esr Chain X (length=132) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVAKAKGAQKTVQKGIHNSTTFRRPKTLQLSRKPKYARKSVAHAPRLDEY
KIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKEAVRKLYSVEPVKI
NTLIRPNGTKKAFVKLSADADALDVANRIGFL
Ligand information
>8esr Chain 8 (length=22) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSFRTKQKLAKAARQNRPIPQW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8esr Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		L87 I113 N116 G117
Binding residue
(residue number reindexed from 1)		L78 I104 N107 G108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0180023 cytosolic large ribosomal subunit assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8esr, PDBe:8esr, PDBj:8esr
PDBsum8esr
PubMed36423630
UniProtQ10330|RL25A_SCHPO Large ribosomal subunit protein uL23A (Gene Name=rpl2501)

[Back to BioLiP]