Structure of PDB 6az3 Chain X Binding Site BS03

Receptor Information
>6az3 Chain X (length=65) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNP
RFIPWTRTYRRIHRK
Ligand information
>6az3 Chain 5 (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uacgucccucuccaaacgagagaacaugcaugggcuggcaugagcggggg
gcucgucccgaggcgcugaaccuugaggccucaugcucagggacaca
...<<<<<<<<<.......>>>>....<<<<<<<<.<<.....<<<...<
<......>>....>>>....>>.....>>>.>>>>>...>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K39 P54 W55 R60 R64
Binding residue
(residue number reindexed from 1)		K39 P54 W55 R60 R64
External links