Structure of PDB 6pbs Chain W Binding Site BS03

Receptor Information
>6pbs Chain W (length=147) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKL
Ligand information
>6pbs Chain f (length=12) Species: 1562372 (Nonomuraea sp. MJM5123) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVITTVLVVVFV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pbs Structure of the N-terminal domain of ClpC1 in complex with the antituberculosis natural product ecumicin reveals unique binding interactions.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M1 F2 E3 F5 R10 E89 L92 L96
Binding residue
(residue number reindexed from 1)		M1 F2 E3 F5 R10 E89 L92 L96
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6pbs, PDBe:6pbs, PDBj:6pbs
PDBsum6pbs
PubMed32355042
UniProtP9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 (Gene Name=clpC1)

[Back to BioLiP]