Structure of PDB 6j50 Chain W Binding Site BS03

Receptor Information

>6j50 Chain W (length=275) Species: 644223 (Komagataella phaffii GS115) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQRLLIPTVDDPGIWGVKVRLGKEKDVVRQILKKKLAREGTKNPLEIYSA
FQRDSFKGHVYIEARKAEAINDALKGNVNVFSNNSKFLVGIVEYKDLLRP
VKLTRGSYVRVKNGKFKGDLAQVDEVLENGLEARLKLVPRLDYGKDLSYT
SKFRPAQRLFSEAEARVHEIRRDRDGFVTYGGEEYYEGFLYKTFRLQNLI
VNSINPTLNELSLFDPTLNKTVKIRQGGYKGKIGIVKEANGDRFRVELHN
PNKTIPIPCSFLLIESTHGWVPYED

Ligand information

>6j50 Chain 1 (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtttttttctgtctcgtgcctggtgtcttgggtgtaatccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6j50 Structural insight into nucleosome transcription by RNA polymerase II with elongation factors.
Resolution	4.7 Å
Binding residue (original residue number in PDB)	K278 A279 E280 L300
Binding residue (residue number reindexed from 1)	K66 A67 E68 L88

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003711	transcription elongation factor activity
GO:0003729	mRNA binding
GO:0140463	chromatin-protein adaptor activity

	Biological Process
GO:0006325	chromatin organization
GO:0006354	DNA-templated transcription elongation
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0032784	regulation of DNA-templated transcription elongation

	Cellular Component
GO:0005634	nucleus
GO:0032044	DSIF complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6j50, PDBe:6j50, PDBj:6j50
PDBsum	6j50
PubMed	30733384
UniProt	C4R370

[Back to BioLiP]