Structure of PDB 6htq Chain V Binding Site BS03

Receptor Information
>6htq Chain V (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPV
Ligand information
>6htq Chain v (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgaggugguggaauugguagacacgcuaccuugaggugguagugccca
auagggcuuacggguucaagucccguccucgguacca
<<<<<<<..<<<...........>>><<<<<<.......>>>>>><<<<.
...>>>>..<<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel.
Resolution4.5 Å
Binding residue
(original residue number in PDB)
G14 S17
Binding residue
(residue number reindexed from 1)
G4 S7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6htq, PDBe:6htq, PDBj:6htq
PDBsum6htq
PubMed32937119
UniProtP05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]