Structure of PDB 8a3t Chain U Binding Site BS03

Receptor Information

>8a3t Chain U (length=114) Species: 4932 (Saccharomyces cerevisiae)

MKVKINEVHSVFAWSWHIPSDEDVCGICRASYNGTCPSCKFPGDQCPLVI
GLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVE
IVSRRREEMIEEGV

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8a3t Chain U Residue 203

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8a3t Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): C41 C44 H74 C77
• Binding residue (residue number reindexed from 1): C25 C28 H58 C61
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 6.3.2.-

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding
• GO:0061630 ubiquitin protein ligase activity
• GO:0097602 cullin family protein binding

Biological Process

• GO:0006511 ubiquitin-dependent protein catabolic process
• GO:0007346 regulation of mitotic cell cycle
• GO:0016567 protein ubiquitination
• GO:0031145 anaphase-promoting complex-dependent catabolic process
• GO:0045842 positive regulation of mitotic metaphase/anaphase transition
• GO:0051301 cell division
• GO:0051445 regulation of meiotic cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005680 anaphase-promoting complex

External links

• PDB: RCSB:8a3t, PDBe:8a3t, PDBj:8a3t
• PDBsum: 8a3t
• UniProt: Q12157|APC11_YEAST Anaphase-promoting complex subunit 11 (Gene Name=APC11)