Structure of PDB 7q3n Chain U Binding Site BS03

Receptor Information
>7q3n Chain U (length=292) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGA
HNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALA
TCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPC
QAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCN
TAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVY
NLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQ
Ligand information
Ligand IDBMA
InChIInChI=1S/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5+,6-/m1/s1
InChIKeyWQZGKKKJIJFFOK-RWOPYEJCSA-N
SMILES
SoftwareSMILES
CACTVS 3.341OC[C@H]1O[C@@H](O)[C@@H](O)[C@@H](O)[C@@H]1O
OpenEye OEToolkits 1.5.0C(C1C(C(C(C(O1)O)O)O)O)O
CACTVS 3.341OC[CH]1O[CH](O)[CH](O)[CH](O)[CH]1O
OpenEye OEToolkits 1.5.0C([C@@H]1[C@H]([C@@H]([C@@H]([C@@H](O1)O)O)O)O)O
ACDLabs 10.04OC1C(O)C(OC(O)C1O)CO
FormulaC6 H12 O6
Namebeta-D-mannopyranose;
beta-D-mannose;
D-mannose;
mannose
ChEMBL
DrugBank
ZINCZINC000003830679
PDB chain7q3n Chain D Residue 3 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q3n Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
Resolution7.4 Å
Binding residue
(original residue number in PDB)		P152 G153
Binding residue
(residue number reindexed from 1)		P128 G129
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0019864 IgG binding
Biological Process
GO:0001822 kidney development
GO:0002251 organ or tissue specific immune response
GO:0003091 renal water homeostasis
GO:0003094 glomerular filtration
GO:0006629 lipid metabolic process
GO:0006874 intracellular calcium ion homeostasis
GO:0006883 intracellular sodium ion homeostasis
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006954 inflammatory response
GO:0006968 cellular defense response
GO:0006986 response to unfolded protein
GO:0007029 endoplasmic reticulum organization
GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007159 leukocyte cell-cell adhesion
GO:0008217 regulation of blood pressure
GO:0008285 negative regulation of cell population proliferation
GO:0008380 RNA splicing
GO:0009410 response to xenobiotic stimulus
GO:0009414 response to water deprivation
GO:0010467 gene expression
GO:0015747 urate transport
GO:0030643 intracellular phosphate ion homeostasis
GO:0030644 intracellular chloride ion homeostasis
GO:0032496 response to lipopolysaccharide
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0033554 cellular response to stress
GO:0033555 multicellular organismal response to stress
GO:0034620 cellular response to unfolded protein
GO:0034976 response to endoplasmic reticulum stress
GO:0035809 regulation of urine volume
GO:0036503 ERAD pathway
GO:0044861 protein transport into plasma membrane raft
GO:0045087 innate immune response
GO:0046720 citric acid secretion
GO:0048871 multicellular organismal-level homeostasis
GO:0048878 chemical homeostasis
GO:0050801 monoatomic ion homeostasis
GO:0050829 defense response to Gram-negative bacterium
GO:0050891 multicellular organismal-level water homeostasis
GO:0051223 regulation of protein transport
GO:0055062 phosphate ion homeostasis
GO:0055064 chloride ion homeostasis
GO:0055074 calcium ion homeostasis
GO:0055075 potassium ion homeostasis
GO:0055078 sodium ion homeostasis
GO:0060073 micturition
GO:0061077 chaperone-mediated protein folding
GO:0070294 renal sodium ion absorption
GO:0071918 urea transmembrane transport
GO:0072044 collecting duct development
GO:0072051 juxtaglomerular apparatus development
GO:0072070 loop of Henle development
GO:0072218 metanephric ascending thin limb development
GO:0072221 metanephric distal convoluted tubule development
GO:0072233 metanephric thick ascending limb development
GO:0072665 protein localization to vacuole
GO:0097190 apoptotic signaling pathway
GO:0097709 connective tissue replacement
GO:0097744 renal urate salt excretion
GO:0140367 antibacterial innate immune response
GO:1990266 neutrophil migration
Cellular Component
GO:0000922 spindle pole
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005783 endoplasmic reticulum
GO:0005796 Golgi lumen
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0009986 cell surface
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0019898 extrinsic component of membrane
GO:0060170 ciliary membrane
GO:0070062 extracellular exosome
GO:0098552 side of membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q3n, PDBe:7q3n, PDBj:7q3n
PDBsum7q3n
PubMed35273390
UniProtP07911|UROM_HUMAN Uromodulin (Gene Name=UMOD)

[Back to BioLiP]