--> -->

Structure of PDB 6qx2 Chain U Binding Site BS03

Receptor Information
>6qx2 Chain U (length=188) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEK
ARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHI
RTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEH
RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAV
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun May 4 02:54:17 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1456     title=pdb2title(pdbid)
   1457     if bs.startswith("BS"):
=> 1458         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1459     else:
   1460         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6qx2', asym_id = 'U', bs = 'BS03', title = 'Structure-guided design of antibacterials that allosterically inhibit DNA gyrase.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6qx2', asym_id='U', bs='BS03', title='Structure-guided design of antibacterials that allosterically inhibit DNA gyrase.')
    892     stdout,stderr=p.communicate()
    893 
=>  894     if not lines:
    895         with open('./cgi_debug.log', 'a') as f:
    896             f.write(f"[WARNING] No match found for {pdbid}, {asym_id}, {bs}\n")
lines undefined

UnboundLocalError: local variable 'lines' referenced before assignment
      args = ("local variable 'lines' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>