Structure of PDB 5nrl Chain U Binding Site BS03

Receptor Information

>5nrl Chain U (length=196) Species: 4932 (Saccharomyces cerevisiae)

LSKGENVPYTFQDEQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLG
GKKHGLNVLRRGISIEKSSDFRQQQKIIEAKQSLKNNGTIPGSVGLAIQV
NYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFE
NIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQ

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5nrl Chain U Residue 1000

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5nrl Structure of a pre-catalytic spliceosome.
• Resolution: 7.2 Å
• Binding residue (original residue number in PDB): C68 C71 H84 H90
• Binding residue (residue number reindexed from 1): C32 C35 H48 H54
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0071004 U2-type prespliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
• PDBsum: 5nrl
• PubMed: 28530653
• UniProt: Q07350|PRP11_YEAST Pre-mRNA-splicing factor PRP11 (Gene Name=PRP11)