Structure of PDB 8ovj Chain T Binding Site BS03

Receptor Information

>8ovj Chain T (length=152) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

THYSRKPQVSSKSAKAKVSDLRCHYKNTFETANVINGMPLRKAQQLYRQV
LAKTRCIPFKRYNGKIGRTAQAKEWGQTKGRWPRKSVVAMMSLLKNAEAN
AIEKGLDPNQMVIKHVQVDQAARMRRRTYRAHGRITPYMCSPCHVQLFMS
EK

Ligand information

>8ovj Chain 7 (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaacauucaauuaccgaaucuuu
gaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugccau
auucucagugucga

.........................................<<<<<<.((
.....>>>.....<<<<<......))............>>>>.>...>>>
....<<.....>><<<<<<<....<<....>>....>>>>>>>.......
..............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	T2 S5 R62
Binding residue (residue number reindexed from 1)	T1 S4 R61

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4QAX6

[Back to BioLiP]