Structure of PDB 7mq8 Chain SQ Binding Site BS03

Receptor Information
>7mq8 Chain SQ (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLNSTKAKLLKLTSSSIDPGLSIKQLGGLYINFNATQIKEKKKNELLQKA
VITPDFEKNHCVPPYSESKYQLQKKRRKERQKTAGDGWFGMKAPEMTNEL
KNDLKALKMRASMDPKRFYKKNDRDGFPKYFQIGTIVDNPADFYHSRIPK
KQRKRTIVEELLADSEFRRYNRRKYSEIMAEKAANAA
Ligand information
>7mq8 Chain N0 (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuu
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mq8 Nucleolar maturation of the human small subunit processome.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
Y732 M736 K739
Binding residue
(residue number reindexed from 1)
Y175 M179 K182
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006396 RNA processing
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0032040 small-subunit processome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7mq8, PDBe:7mq8, PDBj:7mq8
PDBsum7mq8
PubMed34516797
UniProtQ5QJE6|TDIF2_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 2 (Gene Name=DNTTIP2)

[Back to BioLiP]