Structure of PDB 6j6q Chain S Binding Site BS03

Receptor Information
>6j6q Chain S (length=70) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKSWRKGTAFGRG
YINDMTKSEYHQEFLHKHVR
Ligand information
>6j6q Chain L (length=210) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuuu
caguguaacaacuaaugaccucagaggcucauauuuguuacaauacacau
uuuuuggcacccaaaauaggacgggaagagacuuuuaaagugagacgucg
cgacccucgcaggagucguucuugacuuuuuggucgcuugauguuucucu
cuucccguuc
..................................................
...<<<<<<<<..<..<.<<<<.>>>>.>..>..>>>>>>>>........
...................<<<<<<<<<<.<<<<<.>>>>><<<<<<<<<
<<<.<<......<<<<<<....>>>>>>...>>>>>>..>>>>>>>>..>
>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j6q Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
H5 R6 P7 L9
Binding residue
(residue number reindexed from 1)
H3 R4 P5 L7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6j6q, PDBe:6j6q, PDBj:6j6q
PDBsum6j6q
PubMed30879786
UniProtQ03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)

[Back to BioLiP]