Structure of PDB 6bz6 Chain RG Binding Site BS03

Receptor Information

>6bz6 Chain RG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

Ligand information

>6bz6 Chain RB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6bz6 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Resolution: 3.18 Å
• Binding residue (original residue number in PDB): P2 N27 V28 W29 E30 Q66 K67 P68 A69 V70 R91 V92 T93 R95 R96 R98
• Binding residue (residue number reindexed from 1): P1 N26 V27 W28 E29 Q65 K66 P67 A68 V69 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bz6, PDBe:6bz6, PDBj:6bz6
• PDBsum: 6bz6
• PubMed: 30476222
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)