Structure of PDB 5lyb Chain Q2 Binding Site BS03

Receptor Information

>5lyb Chain Q2 (length=105) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

Ligand information

InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6

OWCQTVJQFLTQTE-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 12.01 CACTVS 3.370 OpenEye OEToolkits 1.7.0	N[Os](N)(N)(N)(N)N

Formula

H12 N6 Os

Name

osmium (III) hexammine;
osmium(6+) hexaazanide

PDB chain

5lyb Chain Q2 Residue 505 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5lyb ?
Resolution	3.25 Å
Binding residue (original residue number in PDB)	K46 S48 F50
Binding residue (residue number reindexed from 1)	K45 S47 F49
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic
GO:0046898	response to cycloheximide

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lyb, PDBe:5lyb, PDBj:5lyb
PDBsum	5lyb
PubMed	27827794
UniProt	P0CX27\|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)

[Back to BioLiP]