Structure of PDB 5t5h Chain Q Binding Site BS03

Receptor Information

>5t5h Chain Q (length=203) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAFMYLNELWKKKSSDVMRFIQRVRAWEFRHQHTVVRLRRPTRPEKARML
GYKTKQGFSVFRVRVRRGGRKRPVHKGITYGKPKTSGVLGVKLNKNSRAI
AEQRLGKKYGNLRVLNSYWVNADSTFVWYEVVAVDPMCRTIRRDPRINWI
VNAVHKHREQRGLTSAGRKHRGLRHKGHKASKLRPSVRAAWRRNNRMVFL
RKR

Ligand information

>5t5h Chain C (length=147) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagauuaccgaaucuuugaacgcaa
acggcgcaugggagaaauccccgugcaugccauauuucucagugucg

.........................................<<<<<<.((
.....>>>......<<<<......))....>>>>.....>>>....<<..
...>><<<<<<<.<...>.>>>>>>>.....................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
Resolution	2.54 Å
Binding residue (original residue number in PDB)	R54 Y126 N128 D152
Binding residue (residue number reindexed from 1)	R37 Y109 N111 D135

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
PDBsum	5t5h
PubMed	27791004
UniProt	Q4CTG9

[Back to BioLiP]