Structure of PDB 4x23 Chain Q Binding Site BS03

Receptor Information
>4x23 Chain Q (length=102) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL
AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVL
LP
Ligand information
>4x23 Chain X (length=21) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRSNRIRLKPLEYWRGERIDY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x23 A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		E55 E60 E63 L64 D89 E90 E91
Binding residue
(residue number reindexed from 1)		E41 E46 E49 L50 D75 E76 E77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4x23, PDBe:4x23, PDBj:4x23
PDBsum4x23
PubMed23723239
UniProtP84051|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]