Structure of PDB 1tqe Chain Q Binding Site BS03

Receptor Information
>1tqe Chain Q (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSA
NRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRR
Ligand information
>1tqe Chain X (length=23) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SPKGTGASTEVKQKLQEFLLSKS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tqe Mechanism of Recruitment of Class II Histone Deacetylases by Myocyte Enhancer Factor-2.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		D63 L66 L67 Y69 T70 H76 D83
Binding residue
(residue number reindexed from 1)		D62 L65 L66 Y68 T69 H75 D82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1tqe, PDBe:1tqe, PDBj:1tqe
PDBsum1tqe
PubMed15567413
UniProtQ02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B (Gene Name=MEF2B)

[Back to BioLiP]