Structure of PDB 8ckb Chain P011 Binding Site BS03

Receptor Information
>8ckb Chain P011 (length=107) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKMLEISEEAITRYFTTLSQFGYKKYSDVDKIIVLFFMEEMLAGEMSYY
VTQDDYRNIVNALYCLAGSTCMIDFPMFESYDTLVHSNNRTFVPRITEDS
ILRSTED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ckb Structural atlas of the most abundant human gut virus
Resolution4.39 Å
Binding residue
(original residue number in PDB)		M1 L43 Y49 V51 T52 Q53 Y56
Binding residue
(residue number reindexed from 1)		M1 L43 Y49 V51 T52 Q53 Y56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:8ckb, PDBe:8ckb, PDBj:8ckb
PDBsum8ckb
PubMed
UniProtA0A385DTH1|THA_BPCA1 Tail hub protein A (Gene Name=crAss001_38)

[Back to BioLiP]