Structure of PDB 6id0 Chain P Binding Site BS03

Receptor Information

>6id0 Chain P (length=118) Species: 9606 (Homo sapiens)

TAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPE
EVRNRDFRRELEERERAAAREKNRDRWDDDVVFKNCAKGVDDQKKDKRFV
NDTLRSEFHKKFMEKYIK

Ligand information

>6id0 Chain H (length=140)

aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguucuuauc
auuaauaucguccucuaccgaggacaauauuaaggauuuuuggagcaggg
aggcaucgaccugguauugcaguaccuccaggaacggugc

..................................................
....<<<..<<<<<<....>>>>>>..>>>....................
..<<<<<<.<<<<<.............>>>>>..>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6id0 Structures of the human spliceosomes before and after release of the ligated exon.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): A5 R6 P7
• Binding residue (residue number reindexed from 1): A3 R4 P5

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005739 mitochondrion
• GO:0016607 nuclear speck
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:6id0, PDBe:6id0, PDBj:6id0
• PDBsum: 6id0
• PubMed: 30728453
• UniProt: Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)