Structure of PDB 6fec Chain P Binding Site BS03

Receptor Information
>6fec Chain P (length=266) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRR
IRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKS
KTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKH
AVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGI
DAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTTTLERTEGLSVLNQAM
AVIKEKIEEKRGVFNV
Ligand information
>6fec Chain N (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcagaguggcgcagcggaagcgugcugggcccauaacccagaggucgau
ggaucgaaaccauccucugcuacca
....<<<..<<<.........>>>..<<<<.......>>>>.......<<
<<.......>>>>.>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fec Structure of a human cap-dependent 48S translation pre-initiation complex.
Resolution6.3 Å
Binding residue
(original residue number in PDB)		K61 L62 I63 R64 K106 T107 S110 R113 E120 T122 R182 R183 L184 T185 Q187 R192 I230
Binding residue
(residue number reindexed from 1)		K56 L57 I58 R59 K101 T102 S105 R108 E115 T117 R177 R178 L179 T180 Q182 R187 I225
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Feb 22 16:48:25 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6fec', asym_id = 'P', bs = 'BS03', title = 'Structure of a human cap-dependent 48S translation pre-initiation complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6fec', asym_id='P', bs='BS03', title='Structure of a human cap-dependent 48S translation pre-initiation complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0003723,0003743', uniprot = '', pdbid = '6fec', asym_id = 'P'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003723,0003743', uniprot='', pdbid='6fec', asym_id='P')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>