Structure of PDB 5t2a Chain P Binding Site BS03

Receptor Information

>5t2a Chain P (length=154) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

THYSRKPQVSSKSAKAKVSDLRCHYKNTFETANVINGMPLRKAQQLYRQV
LAKTRCIPFKRYNGKIGRTAQAKEWGQTKGRWPRKSVVAMMSLLKNAEAN
AIEKGLDPNQMVIKHVQVDQAARMRRRTYRAHGRITPYMCSPCHVQLFMS
EKKE

Ligand information

>5t2a Chain C (length=162) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagaaucauuaauugcccaaucuuu
gaacgcaaacggcgcaugggagaagcucgagccauccccgugcaugccac
aucucagugucg

.........................................<<<<<<.((
.....>>>.....<<<<<......))............>>>>.>...>>>
....<<.....>><<<<<<<....<<<..>>>....>>>>>>>.......
............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	T2 H3 S5 R62
Binding residue (residue number reindexed from 1)	T1 H2 S4 R61

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t2a, PDBe:5t2a, PDBj:5t2a
PDBsum	5t2a
PubMed	27752045
UniProt	A0A3S7WY02

[Back to BioLiP]