Structure of PDB 7xx6 Chain O Binding Site BS03

Receptor Information

>7xx6 Chain O (length=99) Species: 9606 (Homo sapiens)

KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 7xx6 Chain O Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7xx6 Crystal Structure of Nucleosome-H1.0 Linker Histone Assembly (sticky-169a DNA fragment)
• Resolution: 3.39 Å
• Binding residue (original residue number in PDB): Q76 D77
• Binding residue (residue number reindexed from 1): Q40 D41
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7xx6, PDBe:7xx6, PDBj:7xx6
• PDBsum: 7xx6
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)