Structure of PDB 5t5h Chain O Binding Site BS03

Receptor Information
>5t5h Chain O (length=202) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRPEIIVVDLKDHVLGRAAAIVAKQLLLGKKITAVRCEQLTIAGTEIRNK
IKYLQFLRKRKLSNPKLGPFHHRSPSDIFLRTVRSMLPRYTKRGQKALRQ
LVAYEGIPTNVVRTGGRVVIPKAQRHYCYRSERPYTVLGNMCKHVGWKYS
DVVKKLETARVEKAARHHKKTEKLRAAWKSARKEALSKVSKNNLEVLKKF
GY
Ligand information
>5t5h Chain F (length=46) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgaaucgccacuucucucggcgccaaguaccuucauauucacaaga
....<.<<<.........>>>........................>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		K30 V131 R132 G134 G135 R136 R179 A183 H187 R194 W197 R201 Y221
Binding residue
(residue number reindexed from 1)		K11 V112 R113 G115 G116 R117 R160 A164 H168 R175 W178 R182 Y202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
PDBsum5t5h
PubMed27791004
UniProtV5DCT1

[Back to BioLiP]