Structure of PDB 5mps Chain O Binding Site BS03

Receptor Information
>5mps Chain O (length=211) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIYVKGGVWTNVEDQILKAAVQKYGTHQWSKVASLLQKKTARQSELRWNE
YLNPKLNFTEFSKEEDAQLLDLARELPNQWRTIADMMARPAQVCVERYNR
LLELEDEEKEMLAEARARLLNTQGKKATRKIRERMLEESKRIAELQKRRE
LKQAGINVAIKKPKKKYGTDIDYNEDIVYEQAPMPGIYDTSTEDRQIKKK
FEQFERKVNRK
Ligand information
>5mps Chain 6 (length=99) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuuau
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mps Structure of a spliceosome remodelled for exon ligation.
Resolution3.85 Å
Binding residue
(original residue number in PDB)		Y28 S34 K35 S38 R158 G164 K165 K166 K170 R174 Y207 Y219
Binding residue
(residue number reindexed from 1)		Y24 S30 K31 S34 R118 G124 K125 K126 K130 R134 Y167 Y179
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000386 second spliceosomal transesterification activity
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mps, PDBe:5mps, PDBj:5mps
PDBsum5mps
PubMed28076345
UniProtQ03654|CEF1_YEAST Pre-mRNA-splicing factor CEF1 (Gene Name=CEF1)

[Back to BioLiP]