Structure of PDB 7dco Chain N Binding Site BS03

Receptor Information
>7dco Chain N (length=157) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLW
EIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGY
EKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGC
RGCASTD
Ligand information
>7dco Chain W (length=23) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FTKSELKRRRKTRKGDGPWGSWS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dco Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q54 H57 R126 G149 C150 R151 G152 T156 D157
Binding residue
(residue number reindexed from 1)		Q54 H57 R126 G149 C150 R151 G152 T156 D157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 19:42:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7dco', asym_id = 'N', bs = 'BS03', title = 'Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7dco', asym_id='N', bs='BS03', title='Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0005634', uniprot = '', pdbid = '7dco', asym_id = 'N'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005634', uniprot='', pdbid='7dco', asym_id='N')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>