Structure of PDB 1nfv Chain N Binding Site BS03

Receptor Information

>1nfv Chain N (length=170) Species: 876 (Desulfovibrio desulfuricans)

GNREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLI
AIDEMRHAENFAERIKELGGEPTTQKEGKVVTGQAVPVIYESDADQEDAT
IEAYSQFLKVCKEQGDIVTARLFERIIEEEQAHLTYYENIGSHIKNLGDT
YLAKIAGTPSSTGTASKGFV

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 1nfv Chain N Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1nfv The nature of the di-iron site in the bacterioferritin from Desulfovibrio desulfuricans
• Resolution: 1.95 Å
• Binding residue (original residue number in PDB): E56 E99 E132 H135
• Binding residue (residue number reindexed from 1): E54 E97 E130 H133
• Annotation score: 5

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0004322 ferroxidase activity
• GO:0005506 iron ion binding
• GO:0008199 ferric iron binding
• GO:0015093 ferrous iron transmembrane transporter activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion
• GO:0034755 iron ion transmembrane transport

Cellular Component

• GO:0005575 cellular_component
• GO:0005829 cytosol

External links

• PDB: RCSB:1nfv, PDBe:1nfv, PDBj:1nfv
• PDBsum: 1nfv
• PubMed: 12627224
• UniProt: Q93PP9|BFR_DESDA Bacterioferritin (Gene Name=bfr)