Structure of PDB 8cku Chain MM Binding Site BS03

Receptor Information

>8cku Chain MM (length=215) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEY

Ligand information

>8cku Chain Bb (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcggauuuagcucaguugggagagcgccagacugaagaucuggagguccu
guguucgauccacagaauucgcacca

<<<<<<<..<<<<........>>>>.<<.<<.......>>.>>.....<<
<<<.......>>>>>>>>>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cku mRNA reading frame maintenance during eukaryotic ribosome translocation
Resolution	3.11 Å
Binding residue (original residue number in PDB)	A25 K101 C105 A106 R110 L111
Binding residue (residue number reindexed from 1)	A24 K100 C104 A105 R109 L110

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8cku, PDBe:8cku, PDBj:8cku
PDBsum	8cku
PubMed	38030725
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]