Structure of PDB 7r81 Chain M1 Binding Site BS03

Receptor Information
>7r81 Chain M1 (length=165) Species: 5141 (Neurospora crassa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTF
GIRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGIS
EHIDLGIKYDPGIGIYGMDFYCCMTRPGERVSRRRRAKSRVGATHRITRD
DTVKWFKSRFDAIVR
Ligand information
>7r81 Chain u1 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuccucguggcccaauggucacggcgucuggcuacgaaccagaagauucc
agguucaaguccuggcggggaagcca
<<<<<<<..<<<..........>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T55 R57 R63
Binding residue
(residue number reindexed from 1)		T46 R48 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ7RVN0|RL11_NEUCR Large ribosomal subunit protein uL5 (Gene Name=rpl-11)

[Back to BioLiP]