Structure of PDB 6zj3 Chain Ly Binding Site BS03

Receptor Information
>6zj3 Chain Ly (length=106) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKGTTSFGKRNGRTHKLCKRCGKRSWAVQKKRCAACGYPNPKMRSFNWSE
KAKRRNTMGTGRMRHMKNVLKKAAVRQRQDQVAPHQKRKTAENRKKFALS
RKTKLA
Ligand information
>6zj3 Chain LC (length=350) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucgaucggcuuucguuggaauccagcaaacccugugggcuauggagcag
uuggcugugucucggugcuucccaguaccaagaagaguccuggaauggac
ccacgaaacagggagacugucccguauggcugaaccgugugcugggauca
cugggauguggcuggcuguauccccgaguagaguggcuugggacugcagu
uugaagagugacguguauccgucacaagguggcauacagaccugggaccg
auagugcacaaguagagugaucgaaggaugcaaagaacuccgcgaagagg
guuaaaagucccugaagccgcaacaggaucgguggugugcagugcuguau
<.<<<.......>>>..>.........................<<<<<<<
<<<<<<....<<<<<<...<<<<<<<<<........<<<<......>>>>
..((......<<<.....))>>>...............>>>>>>>>>..>
>>>>>....>>>>>>>>>>.>>>.......<<<<.<<........>>.>>
>>.....<<<<<........>>>>>.........................
..............<<....>>...............<<<......>>>.
..................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		H16 R25 S26 A35 R45 K52 R55 R56 R77 Q80 D81 Q82 H86 K88 R89 K90 R95 L100 S101
Binding residue
(residue number reindexed from 1)		H15 R24 S25 A34 R44 K51 R54 R55 R76 Q79 D80 Q81 H85 K87 R88 K89 R94 L99 S100
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 20:01:07 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Ly', bs = 'BS03', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Ly', bs='BS03', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'Ly'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='Ly')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>