Structure of PDB 8rxh Chain Lm Binding Site BS03

Receptor Information

>8rxh Chain Lm (length=52) Species: 347515 (Leishmania major strain Friedlin)

VMEPTLVALAKKYNWEKKVCRRCYARLPVRATNCRKKACGHCSNLRMKKK
LR

Ligand information

>8rxh Chain L4 (length=184)

gugggauugugaagggaucucgcagguaucgugagggaaguaugggguag
uacgagaggaacucccaugccgugccucuaguuucugggguuugucgaac
ggcaagugccccgaagccaucgcacggugguucucggcugaacgccucua
agccagaagccaaucccaagaccagaugcccacu

<<<<<<<.........>>>>>>>.<<<<<<....<<<<.<<<<<<<<...
............>>>>>>>><<<<<...<.<<....<<<<<<<<<.....
.>>>>..>>>>>...>>.>..>>>>>.<<<<....<<<<...........
>>>>....>>>>.>>>>.......>>>>>>....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Resolution: 2.93 Å
• Binding residue (original residue number in PDB): K93 R102 R106 R111 K112
• Binding residue (residue number reindexed from 1): K17 R26 R30 R35 K36

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0031386 protein tag activity
• GO:0031625 ubiquitin protein ligase binding

Biological Process

• GO:0006412 translation
• GO:0016567 protein ubiquitination
• GO:0019941 modification-dependent protein catabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
• PDBsum: 8rxh
• PubMed: 38722744
• UniProt: P69201|RL40_LEIMA Ubiquitin-ribosomal protein eL40 fusion protein (Gene Name=UB-EP52)