Structure of PDB 8rxx Chain Ll Binding Site BS03

Receptor Information
>8rxx Chain Ll (length=50) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRFKPLAVKKKYAKKMNQNKPVPYWIRLRTGNRIKWNEKRRHWRRTKLNY
Ligand information
>8rxx Chain L7 (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaaucauucaauuaccgaaucuu
ugaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugcca
uauucucagugucgaa
.........................................<<<<<<<<<
....>>>>.....(<<<<......>>.............>>>>.)...>>
>....<<.....>><<<<<<<.<..<<....>>..>.>>>>>>>......
................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		P6 L7 K15 Q19 V23 P24 W26 I27 L29 R30 T31 I35 N38 K40
Binding residue
(residue number reindexed from 1)		P5 L6 K14 Q18 V22 P23 W25 I26 L28 R29 T30 I34 N37 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtQ4QEQ0

[Back to BioLiP]