BioLiP

Receptor Information

>8rxx Chain Lh (length=127) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIHTPWVLGH
KRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQ
RIVKQALKEHSKMKLSHKRTANKKKSK

>8rxx Chain L3 (length=183) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agugguaaugcgaaacacuugccagguaacaaaucaauccucccacggug
agcuuucuuuucaccauaauccaccuugggccuuuuuacuuucgcguugu
ucggagcgggggcucaagauugaaaaaugcagcucuuacugucauuugug
aguucugcgcauuaaagcaaaaaccuggggugu

.<<......>>.....<<<..<<<<<<.......<<...<<<....<<<<
<<.......>>>>>><...<<.<.<<<<<<<<<<<.......<<......
.>>....>>>>>>>>>>>.>.>>....><..<..........>..>...>
>>...>>...............>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.97 Å
Binding residue (original residue number in PDB)	S2 C3 R17 R20 M23 R25 T26 P27 G28 N29 L31 R36 K38 R39 S40 Q41 G42 H44 T45 P46 W47 H51 R53 G55 G56 T57 K58 A65 R70 H71 K73 S74 V75 S76 R77 Y79 G80 G81 V82 H85
Binding residue (residue number reindexed from 1)	S1 C2 R16 R19 M22 R24 T25 P26 G27 N28 L30 R35 K37 R38 S39 Q40 G41 H43 T44 P45 W46 H50 R52 G54 G55 T56 K57 A64 R69 H70 K72 S73 V74 S75 R76 Y78 G79 G80 V81 H84

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum	8rxx
PubMed	38722744
UniProt	Q4QDP9

[Back to BioLiP]

Structure of PDB 8rxx Chain Lh Binding Site BS03