Structure of PDB 8rxh Chain Lg Binding Site BS03

Receptor Information
>8rxh Chain Lg (length=143) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTSKVHSQRSKKLHQLSAKTSRVNRNRKAPRLYMKGTLAGYTRGLHGQTK
QTALVRVENVNTREDATWYVGKRVCYVYHGKKVKRCVRWSKAPARRSTTR
ALWGRVTRPHGNAGMMRVKFNGASVPASAIGRRIRVYLYPSQI
Ligand information
>8rxh Chain L6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca
......<.<<<............<<<<<..>>>>>......>>>......
..................>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		R23 V24 N25 R26 N27 R28 K29 P31 R32 Y34 K36 V78 H80 V88 R89 A93 R96 S98 T99 T100 A102 W104 R134 R136 Y138 Y140
Binding residue
(residue number reindexed from 1)		R22 V23 N24 R25 N26 R27 K28 P30 R31 Y33 K35 V77 H79 V87 R88 A92 R95 S97 T98 T99 A101 W103 R133 R135 Y137 Y139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtQ4QHL3

[Back to BioLiP]