Structure of PDB 6zj3 Chain Lg Binding Site BS03

Receptor Information
>6zj3 Chain Lg (length=181) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGFSGIRHYEIVGRAYPTEKEPSPKVYKMTVFAKNSVVGKARFWKLMRKQ
NKVKKTHGQVLQIRRIFEKNPNTIKNYSILLRYQSKTGVMNVSKEYRDTT
LCGAVHQMYMDMAGRHHARYLDIDIIGTTVLKPSQCLRPHIRQFLQHKVK
FPLLHRITKKLPQHKATFLYSKPSTYRSGFM
Ligand information
>6zj3 Chain LK (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcaucgaggcagagcaguacccuucgggucugcgccaacaccaacugga
ucugaacuggc
...<<.........<<<<.<<<.....>>>>>>>...............>
>..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		L155 H156 I158 T159 K161 H165 A167 L170 Y171 S172 K173 P174 S175 T176 Y177 R178 S179 M182
Binding residue
(residue number reindexed from 1)		L154 H155 I157 T158 K160 H164 A166 L169 Y170 S171 K172 P173 S174 T175 Y176 R177 S178 M181
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 21:59:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Lg', bs = 'BS03', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Lg', bs='BS03', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'Lg'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='Lg')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>