Structure of PDB 6zj3 Chain Ld Binding Site BS03

Receptor Information
>6zj3 Chain Ld (length=260) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFVKIVKNRSYFSRLQIKYRRRREGKTNYRKRRLLVAQDKNKYNTPKHRL
CVRMSNKDITAQIIIAKIQGDVVLAAAYAHELPIHGAVVGLTNFAGAYAT
GLLLARRILTKLGLADKYVGVAEANGEEYHVEAQEGRRPFKAFMDTGLAR
VTTGARIFAVLKGVVDGGVNVPHSMKRFPGYNRDKGEMDSETLRERIFAG
HVAEYQKMLIREEPEKYQEVYSQYIAKGVKPGEVEDMWANCHASIRANPM
AKLLSETFEV
Ligand information
>6zj3 Chain LO (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcguacggccauacuaccgggaauacaccugaacccguucgauuucagaa
guuaagccuggucaggcccaguuaguacugaggugggcgaccacuuggga
acacugggugcuguacgcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<<<<..<<....>>.>>>>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		K7 R9 F12 S13 I17 Y19 R20 R21 R23 T27 Y29 R32 R49 C51 R53 S55 N56 K57 Q62 I64 I68 Q69 D71 V73 Y78 N93 F94 R150 T152 T153 G154 A155 R156 R196 H201 V202 Y205 K216 Y221 S222 Q223 Y224
Binding residue
(residue number reindexed from 1)		K7 R9 F12 S13 I17 Y19 R20 R21 R23 T27 Y29 R32 R49 C51 R53 S55 N56 K57 Q62 I64 I68 Q69 D71 V73 Y78 N93 F94 R150 T152 T153 G154 A155 R156 R196 H201 V202 Y205 K216 Y221 S222 Q223 Y224
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Apr 6 22:25:48 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Ld', bs = 'BS03', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Ld', bs='BS03', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '6zj3', asym_id = 'Ld'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='6zj3', asym_id='Ld')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>