Structure of PDB 8xsz Chain Lc Binding Site BS03

Receptor Information
>8xsz Chain Lc (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKS
EIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xsz Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R17 L45 E61 Y62 M65 T69 G70 V71 I105 R106
Binding residue
(residue number reindexed from 1)		R9 L37 E53 Y54 M57 T61 G62 V63 I97 R98
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031640 killing of cells of another organism
GO:0050829 defense response to Gram-negative bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xsz, PDBe:8xsz, PDBj:8xsz
PDBsum8xsz
PubMed38942792
UniProtP62888|RL30_HUMAN Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]