Structure of PDB 6zj3 Chain LY Binding Site BS03

Receptor Information
>6zj3 Chain LY (length=134) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKGTGNKFRISLALPVAAVMNCADNTGAKNLYIISVKGIKGRLNKLPAAC
VGDMVLATVKKGKPELRKKVMPAIVVRQRKHWRRKDGTFIYFEDNAGVIC
NPKGEMKGSGVTGPVAKEAADIWPRVASNAGTVV
Ligand information
>6zj3 Chain LJ (length=163) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcgugacaauggcaucacaugguaguacgagaggaacccuuguggcac
uccccugguuuccaccgugagucgagcgacugguguagugaagcuaccaa
gugacggauacugacuggacgcaucuuaagccugaauccgagaccaggcc
uacagcaugccug
<<<<<<<....<<<..<<<<<.<<...............>>.>>>>><<<
<....<<<<....<<.<<.<<<<....>>>>...>>.>>...>>>>...>
>>>.<<<<....<.<<............>>.>....>>>>...>>>....
.....>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		T10 G11 N12 K13 F14 R15 S17 K46 R48 K86 H87 R89 F95
Binding residue
(residue number reindexed from 1)		T4 G5 N6 K7 F8 R9 S11 K40 R42 K80 H81 R83 F89
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 23:04:43 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'LY', bs = 'BS03', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='LY', bs='BS03', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'LY'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='LY')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>