Structure of PDB 8rxx Chain LV Binding Site BS03

Receptor Information
>8rxx Chain LV (length=119) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSYTRPQFRRPHTYRKPAMAKPSNRVTVESKDIAAFNVIRYPLTTDKAM
KKIEENNTLTFIVDSRANKTEIKKAMRKLYQVKAVKVNTLIRPDGLKKAY
IRLSAAHDALDTANKIGLV
Ligand information
>8rxx Chain L7 (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaaucauucaauuaccgaaucuu
ugaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugcca
uauucucagugucgaa
.........................................<<<<<<<<<
....>>>>.....(<<<<......>>.............>>>>.)...>>
>....<<.....>><<<<<<<.<..<<....>>..>.>>>>>>>......
................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		R27 K28 Y30 F35 T40 Y41 R52 S91 R92 N94 E97 K100 R103 K109
Binding residue
(residue number reindexed from 1)		R1 K2 Y4 F9 T14 Y15 R26 S65 R66 N68 E71 K74 R77 K83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtQ4QJ20

[Back to BioLiP]