Structure of PDB 8rxh Chain LV Binding Site BS03

Receptor Information
>8rxh Chain LV (length=119) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSYTRPQFRRPHTYRKPAMAKPSNRVTVESKDIAAFNVIRYPLTTDKAM
KKIEENNTLTFIVDSRANKTEIKKAMRKLYQVKAVKVNTLIRPDGLKKAY
IRLSAAHDALDTANKIGLV
Ligand information
>8rxh Chain L7 (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaaucauucaauuaccgaaucuu
ugaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugcca
uauucucagugucgaa
.........................................<<<<<<<<<
....>>>>.....(<<<<......>>.............>>>>.)...>>
>....<<.....>><<<<<<<.<..<<....>>..>.>>>>>>>......
................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		R27 K28 Y30 T40 Y41 R52 T54 K58 S91 R92 N94 E97 R103 K104 K109
Binding residue
(residue number reindexed from 1)		R1 K2 Y4 T14 Y15 R26 T28 K32 S65 R66 N68 E71 R77 K78 K83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtQ4QJ20

[Back to BioLiP]