Structure of PDB 6zj3 Chain LR Binding Site BS03

Receptor Information
>6zj3 Chain LR (length=365) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARPLVTVQKEGKTVPLPKVFSSALRYDVVRFVHTNIAKNTRIPYAVSRRA
GHKHSAESWGTGRAVARIPRISGGGTHRSGQGAFGNMCRGGRMFAPTKVF
RKWHAKVPRKVRRLAVRAALAASAIPALVMARGHNLEDVPEIPLVVPNSV
EALEKTKDAVKLLKDIGAYHDVEKVAATKKVRVGKGKRRNRRYCVRKGPL
VVLSKRCEAQRAFRNLPGVDINFVSALNLLRLAPGGHIGRLIVFTEDAFN
QLDKVLKVDTIEGLPDSKRVINSEEVQGVIRHKIKASRRKPQKNSSRPRL
NPAHKVETKVQKKLYIERCKVNADPELRKAKEKKQKAAKKLWLLKVTGKV
DKKGNPRKSTKTPKQ
Ligand information
>6zj3 Chain LD (length=110) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
accaagcgucucugggucagcccagggcuggccaccgagccccugucucc
ggacagggaugacuaucguggcagccccugguggcagcuccgccugccag
gaccuggagu
.........<<<<<<<<<.<<<<<<<<<<.<<<<<.<...<<<<<<<...
.>>>>>>>........>>>>>>>>>>>.>>>..........>>.......
>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		N296 R299 R301 N303 H306 E309 T310 Q313 K314 Y317 R320 N324 K331 K335 Q337 K341
Binding residue
(residue number reindexed from 1)		N294 R297 R299 N301 H304 E307 T308 Q311 K312 Y315 R318 N322 K329 K333 Q335 K339
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 20:59:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'LR', bs = 'BS03', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='LR', bs='BS03', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'LR'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='LR')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>