Structure of PDB 8rxx Chain LO Binding Site BS03

Receptor Information
>8rxx Chain LO (length=290) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVKVVKNKAYFKRFQVKYRRRREGKTDYHARRQMVLQDKTKFGSPKYRLV
VRITNKDIIAQIVQAKIVGDEVVMAAYAHELPAFGIEHGLTNYAAAYATG
LLLARRTLAKLGIADKFQGAKEADGSYSAVRTKKDDDEERFPFKAILDVG
LARTTTGARVFGVLKGAVDGGMAVPHRPNRFPGYNKEKSSLDAKVHRDRI
FGKHVADYLKQVKEEASSNPDEKCVQFSKYMAAKVLPESIEGMYKKAHAA
IRADPSKSLPKHKSYKTKKLSGAEKRAAAKAKVAAIRERL
Ligand information
>8rxx Chain L8 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaguacgaccacacuugagugaaaacaccauaucccguccgauuugugaa
guuaagcacucacaggcucaguuaguacugaggucagugaugacucggga
acccugagugccguacucc
<<<<<<<......<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		K8 K10 F13 K14 F16 V18 Y20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I69 V70 G71 D72 E73 V74 Y79 N94 Y95 R158 T160 T161 A163 R164 R204 H209 Y213 Q216 V230 Q231 F232 S233 K234 Y235 H275 S277 Y278 K279 T280 K282 L283 G285 R289 A292 K295 V296
Binding residue
(residue number reindexed from 1)		K6 K8 F11 K12 F14 V16 Y18 R19 R20 R22 T26 Y28 R31 R48 R52 T54 N55 K56 I59 Q61 I67 V68 G69 D70 E71 V72 Y77 N92 Y93 R153 T155 T156 A158 R159 R199 H204 Y208 Q211 V225 Q226 F227 S228 K229 Y230 H262 S264 Y265 K266 T267 K269 L270 G272 R276 A279 K282 V283
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtE9AF09

[Back to BioLiP]