Structure of PDB 8rxx Chain LN Binding Site BS03

Receptor Information

>8rxx Chain LN (length=199) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARRPSRCYRFCKNKPYPKSRFCRGVPDPKIRNFDIGRRRATVDEFPVCIH
VVSRELEQIASEALEAARIQANKYMVKRANKDVFHMRTRAHPFHVLRINK
GMRGAFGKPNGVCARVRIGQILLSMRTKEAYVPQAFEALRRAKMKFPGRQ
IIVMSKYWGFTNILRTEYEALRDAGKLEQRGTHCKLIAPKGKITMRNVM

Ligand information

>8rxx Chain L8 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaguacgaccacacuugagugaaaacaccauaucccguccgauuugugaa
guuaagcacucacaggcucaguuaguacugaggucagugaugacucggga
acccugagugccguacucc

<<<<<<<......<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>..>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.97 Å
Binding residue (original residue number in PDB)	E56 L57 I131 P202 K203 G204 K205 I206 N210
Binding residue (residue number reindexed from 1)	E55 L56 I118 P189 K190 G191 K192 I193 N197

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum	8rxx
PubMed	38722744
UniProt	O97213

[Back to BioLiP]