Structure of PDB 7nrc Chain LM Binding Site BS03

Receptor Information

>7nrc Chain LM (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

Ligand information

>7nrc Chain LB (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7nrc Structure of Gcn1 bound to stalled and colliding 80S ribosomes.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	M9 Q43 T44 V46 T70 R72 P134 R137 V138 R141 R143 V148 G149 N150 H152
Binding residue (residue number reindexed from 1)	M4 Q38 T39 V41 T65 R67 P129 R132 V133 R136 R138 V143 G144 N145 H147

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nrc, PDBe:7nrc, PDBj:7nrc
PDBsum	7nrc
PubMed	33790014
UniProt	Q3E757\|RL11B_YEAST Large ribosomal subunit protein uL5B (Gene Name=RPL11B)

[Back to BioLiP]