Structure of PDB 8rxh Chain LK Binding Site BS03

Receptor Information

>8rxh Chain LK (length=169) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KSHYICAGRLVRILRGPRQDRVGVIVDIVDANRVLVENPEDAKMWRHVQN
LKNVEPLKYCVSVSRNCSAKALKDALASSKALEKYAKTRTAARVEAKKAC
AVSTDFERYQLRVARRSRAHWARKVFDEKDAKTPVSWHKVALKKMLKKAA
KMDSTEGAKRRMQKAIAAR

Ligand information

>8rxh Chain L6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca

......<.<<<............<<<<<..>>>>>......>>>......
..................>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.93 Å
Binding residue (original residue number in PDB)	Y6 C8 R11 T90 R91 T92 R95 V96 K99 R114 V115 R118 S119 H122 W123 R125 W139
Binding residue (residue number reindexed from 1)	Y4 C6 R9 T88 R89 T90 R93 V94 K97 R112 V113 R116 S117 H120 W121 R123 W137

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum	8rxh
PubMed	38722744
UniProt	Q4QBJ1

[Back to BioLiP]