Structure of PDB 8i9p Chain LG Binding Site BS03

Receptor Information
>8i9p Chain LG (length=185) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKWPEYIRLQRQKKILRMRLKVPPAIAQFQYTLDKNLAAQAFKLLNKYR
PETKQEKKERLLREATAIKEVSKKPYTVKYGLNHVVGLIENKKASLVLIA
NDVDPIELVVFLPALCRKMGIPYAIIKGKARLGTLVHKKTAAVVAITEVR
SEDKNELAKLISAVKEGYLEKVEDTRKRWGGGIMG
Ligand information
>8i9p Chain LX (length=22) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKAAKGAQAKKAAQAALKGVHS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i9p Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D86 K87
Binding residue
(residue number reindexed from 1)		D35 K36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i9p, PDBe:8i9p, PDBj:8i9p
PDBsum8i9p
PubMed37129998
UniProtG0SAJ9

[Back to BioLiP]