Structure of PDB 8rxx Chain LD Binding Site BS03

Receptor Information
>8rxx Chain LD (length=175) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKAANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARL
TVRTFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFADTGSF
GFGIDEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRKCSRVGHSH
HVTKEEAMKWFEKVHDGIIFQAKKK
Ligand information
>8rxx Chain S3 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagagcucgucgggcucauaacccgaagaucgucgguu
caaauccggcccccgcaacca
.<<<<<<..<<<<...>>>>.<<<<<.......>>>>>.....<<<<<..
.....>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.97 Å
Binding residue
(original residue number in PDB)
T55 R62
Binding residue
(residue number reindexed from 1)
T51 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtP48157|RL11_LEIMA Large ribosomal subunit protein uL5 (Gene Name=RPL11)

[Back to BioLiP]