Structure of PDB 8hl2 Chain L10E Binding Site BS03

Receptor Information
>8hl2 Chain L10E (length=164) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPGRCYRKFSGPAYTRREYIPGIPMPKITKFVMGNVNGDYDYELRLITTE
KGQIRHNALEAARVIALKYLSKKLASEQNFALVVTKYPHHVIRENKMMAF
AGADRLQDGMRLSFGKPIGTAARLEKLGELVMYVRVKKEHLEAAKEALKI
ASSKLPIRTKIEIS
Ligand information
>8hl2 Chain APTN (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<...<<<<........>>>><<<<<<<.....>>>>>>.>...<<
<<<.......>>>>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
Resolution4.1 Å
Binding residue
(original residue number in PDB)		F103 D107 L109
Binding residue
(residue number reindexed from 1)		F100 D104 L106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
PDBsum8hl2
PubMed37604686
UniProtQ4JC84|RL10E_SULAC Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]