Structure of PDB 6wd9 Chain L Binding Site BS03

Receptor Information

>6wd9 Chain L (length=151) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A

Ligand information

>6wd9 Chain 4 (length=18) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggagguaaaaauguuca

..................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6wd9 Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	V79 G81
Binding residue (residue number reindexed from 1)	V79 G81

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0015935	small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6wd9, PDBe:6wd9, PDBj:6wd9
PDBsum	6wd9
PubMed	32612237
UniProt	P02359\|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]