Structure of PDB 6h3m Chain L Binding Site BS03

Receptor Information
>6h3m Chain L (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>6h3m Chain H (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h3m Substitution of an Internal Disulfide Bridge with a Diselenide Enhances both Foldability and Stability of Human Insulin.
Resolution1.821 Å
Binding residue
(original residue number in PDB)
G8 V12 E13 Y16 G23 F24 Y26 T27 P28 T30
Binding residue
(residue number reindexed from 1)
G8 V12 E13 Y16 G23 F24 Y26 T27 P28 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6h3m, PDBe:6h3m, PDBj:6h3m
PDBsum6h3m
PubMed31012517
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]