Structure of PDB 7qgg Chain K Binding Site BS03

Receptor Information
>7qgg Chain K (length=208) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHM
VSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKM
LSADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRA
KFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGP
LDKWRALH
Ligand information
>7qgg Chain u (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauuccguauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<<..<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.
Resolution2.86 Å
Binding residue
(original residue number in PDB)
V26 P27 D28 S104 L111
Binding residue
(residue number reindexed from 1)
V24 P25 D26 S102 L106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043066 negative regulation of apoptotic process
GO:0097421 liver regeneration
GO:1990403 embryonic brain development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005790 smooth endoplasmic reticulum
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0032991 protein-containing complex
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
PDBsum7qgg
PubMed36038000
UniProtQ6PDV7|RL10_RAT Large ribosomal subunit protein uL16 (Gene Name=Rpl10)

[Back to BioLiP]